PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.16X6W
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ZF-HD
Protein Properties Length: 246aa    MW: 27147.3 Da    PI: 9.0998
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.16X6WgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1054.7e-3359113358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  k rY+eClkNhA+ +Ggha+DGCgEfmp+ g+egt +alkCaAC+CHRnFHR+e+e
  Araip.16X6W  59 KPRYRECLKNHAVGIGGHALDGCGEFMPA-GTEGTLDALKCAACNCHRNFHRKETE 113
                  679*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2261113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.6E-3061112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.3E-3061111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.57662111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEFDEQEEQE EELCVPGGTG YDPLGNPTRV KMSGSEPMLV VQPMTVRNNN NNNSSNMVKP  60
RYRECLKNHA VGIGGHALDG CGEFMPAGTE GTLDALKCAA CNCHRNFHRK ETELAGAGPG  120
GGGPYLLTHH PHHHQPPPFA AYYRTPAGYL HVSGGQQRAG TLALPSTSGA GGGGTARDFE  180
QXXXXXXXXX XXXXXXXXXX XXXXXGSGRS SRRSRRRRCW NLQRDWDGGF RNTTRVRFKS  240
FVTRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016198940.11e-131PREDICTED: zinc-finger homeodomain protein 2-like
TrEMBLK7K6C74e-54K7K6C7_SOYBN; Uncharacterized protein
STRINGGLYMA02G04550.21e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-28homeobox protein 22